PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf04920g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 289aa    MW: 33252.3 Da    PI: 9.2507
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf04920g00003.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF25.71.5e-081659245
                              ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
                    SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                              +ien+    +tfskRr g+ KK + L +  + ++ +i+fs+t k
  Peinf101Scf04920g00003.1 16 KIENEDDCFTTFSKRRSGLYKKVSKLVIQYNLDIGIILFSPTEK 59
                              599999999********************************987 PP

2SRF-TF28.32.2e-09131172445
                               -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
                    SRF-TF   4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 
                               en+    +tfskRr g+ KK +EL +  + ++ +i+fs+t k
  Peinf101Scf04920g00003.1 131 ENEDDCFTTFSKRRSGLYKKVSELVIQYNLDIGIILFSPTEK 172
                               56666679*******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.979763IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-11766IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-16877IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-8929IPR002100Transcription factor, MADS-box
PfamPF003191.5E-141663IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-82944IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-84465IPR002100Transcription factor, MADS-box
SMARTSM004324.4E-5121179IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-14126190IPR002100Transcription factor, MADS-box
PROSITE profilePS5006612.741126176IPR002100Transcription factor, MADS-box
PfamPF003192.0E-14131176IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MEGKMTKGRK KISMVKIENE DDCFTTFSKR RSGLYKKVSK LVIQYNLDIG IILFSPTEKP  60
FSFFHLTPEA IIDRFLYPTM QLSESTRLVA AHARSKVNQL NAMNEELNKK EAALSALALE  120
FDKMKEISAR ENEDDCFTTF SKRRSGLYKK VSELVIQYNL DIGIILFSPT EKPFSFFHLT  180
PEAIIDRFLY PTMQLSESTR LVAAHARSKV NQLNAMNEEL NKKEAALSAL ALEFDKMKEI  240
SARGWWELIE QFNANEVMKF EAWLNSTAFN MDSRLKRLKN EASSSTHSL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016474013.16e-64PREDICTED: agamous-like MADS-box protein AGL61
TrEMBLK4BSX11e-47K4BSX1_SOLLC; Uncharacterized protein
STRINGSolyc04g056740.1.13e-47(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38220138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.13e-20AGAMOUS-like 61